Recombinant Human CBLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CBLN3-2324H
Product Overview : CBLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001034860) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Members of the precerebellin family, such as CBLN3, contain a cerebellin motif and a C-terminal C1q signature domain that mediates trimeric assembly of atypical collagen complexes. However, precerebellins do not contain a collagen motif, suggesting that they are not conventional components of the extracellular matrix.
Molecular Mass : 21.3 kDa
AA Sequence : MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CBLN3 cerebellin 3 precursor [ Homo sapiens (human) ]
Official Symbol CBLN3
Synonyms CBLN3; cerebellin 3 precursor; cerebellin-3; PRO1486;
Gene ID 643866
mRNA Refseq NM_001039771
Protein Refseq NP_001034860
MIM 612978
UniProt ID Q6UW01

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBLN3 Products

Required fields are marked with *

My Review for All CBLN3 Products

Required fields are marked with *

0
cart-icon