Recombinant Human CBLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CBLN3-2324H |
Product Overview : | CBLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001034860) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Members of the precerebellin family, such as CBLN3, contain a cerebellin motif and a C-terminal C1q signature domain that mediates trimeric assembly of atypical collagen complexes. However, precerebellins do not contain a collagen motif, suggesting that they are not conventional components of the extracellular matrix. |
Molecular Mass : | 21.3 kDa |
AA Sequence : | MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CBLN3 cerebellin 3 precursor [ Homo sapiens (human) ] |
Official Symbol | CBLN3 |
Synonyms | CBLN3; cerebellin 3 precursor; cerebellin-3; PRO1486; |
Gene ID | 643866 |
mRNA Refseq | NM_001039771 |
Protein Refseq | NP_001034860 |
MIM | 612978 |
UniProt ID | Q6UW01 |
◆ Recombinant Proteins | ||
Cbln3-1977M | Recombinant Mouse Cbln3 Protein, Myc/DDK-tagged | +Inquiry |
CBLN3-2735M | Recombinant Mouse CBLN3 Protein (25-197 aa), His-tagged | +Inquiry |
CBLN3-470R | Recombinant Rhesus Macaque CBLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cbln3-635M | Recombinant Mouse Cbln3 Protein, His-tagged | +Inquiry |
CBLN3-2784M | Recombinant Mouse CBLN3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBLN3 Products
Required fields are marked with *
My Review for All CBLN3 Products
Required fields are marked with *
0
Inquiry Basket