Recombinant Human CBLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CBLN3-2324H |
| Product Overview : | CBLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001034860) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Members of the precerebellin family, such as CBLN3, contain a cerebellin motif and a C-terminal C1q signature domain that mediates trimeric assembly of atypical collagen complexes. However, precerebellins do not contain a collagen motif, suggesting that they are not conventional components of the extracellular matrix. |
| Molecular Mass : | 21.3 kDa |
| AA Sequence : | MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CBLN3 cerebellin 3 precursor [ Homo sapiens (human) ] |
| Official Symbol | CBLN3 |
| Synonyms | CBLN3; cerebellin 3 precursor; cerebellin-3; PRO1486; |
| Gene ID | 643866 |
| mRNA Refseq | NM_001039771 |
| Protein Refseq | NP_001034860 |
| MIM | 612978 |
| UniProt ID | Q6UW01 |
| ◆ Recombinant Proteins | ||
| CBLN3-2324H | Recombinant Human CBLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Cbln3-2471M | Recombinant Mouse Cbln3 protein, His-SUMO-tagged | +Inquiry |
| Cbln3-635M | Recombinant Mouse Cbln3 Protein, His-tagged | +Inquiry |
| CBLN3-2735M | Recombinant Mouse CBLN3 Protein (25-197 aa), His-tagged | +Inquiry |
| CBLN3-2726H | Recombinant Human CBLN3 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBLN3 Products
Required fields are marked with *
My Review for All CBLN3 Products
Required fields are marked with *
