Recombinant Human CBLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CBLN3-2324H
• Product Overview: CBLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001034860) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Members of the precerebellin family, such as CBLN3, contain a cerebellin motif and a C-terminal C1q signature domain that mediates trimeric assembly of atypical collagen complexes. However, precerebellins do not contain a collagen motif, suggesting that they are not conventional components of the extracellular matrix.
• Molecular Mass: 21.3 kDa
• AA Sequence: MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CBLN3 cerebellin 3 precursor [ Homo sapiens (human) ]
• Official Symbol: CBLN3
• Synonyms: CBLN3; cerebellin 3 precursor; cerebellin-3; PRO1486
• Gene ID: 643866
• mRNA Refseq: NM_001039771
• Protein Refseq: NP_001034860
• MIM: 612978
• UniProt ID: Q6UW01