Recombinant Human CBS protein, His-tagged
| Cat.No. : | CBS-2645H |
| Product Overview : | Recombinant Human CBS protein(P35520)(1-413aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-413aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.4kDa |
| AA Sequence : | MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CBS cystathionine-beta-synthase [ Homo sapiens ] |
| Official Symbol | CBS |
| Synonyms | CBS; cystathionine-beta-synthase; cystathionine beta-synthase; HIP4; beta-thionase; serine sulfhydrase; methylcysteine synthase; |
| Gene ID | 875 |
| mRNA Refseq | NM_000071 |
| Protein Refseq | NP_000062 |
| MIM | 613381 |
| UniProt ID | P35520 |
| ◆ Recombinant Proteins | ||
| CBS-2776HF | Recombinant Full Length Human CBS Protein, GST-tagged | +Inquiry |
| CBS-819R | Recombinant Rat CBS Protein, His (Fc)-Avi-tagged | +Inquiry |
| CBS-1918M | Recombinant Mouse CBS Protein (2-561 aa), His-tagged | +Inquiry |
| CBS-27861TH | Recombinant Human CBS, His-tagged | +Inquiry |
| CBS-5361H | Recombinant Human CBS protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CBS-7809HCL | Recombinant Human CBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBS Products
Required fields are marked with *
My Review for All CBS Products
Required fields are marked with *
