Recombinant Human CBX2 Protein, GST-Tagged
| Cat.No. : | CBX2-0479H | 
| Product Overview : | Human CBX2 full-length ORF (ABZ92071.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Mar 2010] | 
| Molecular Mass : | 23.3 kDa | 
| AA Sequence : | MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCRQALFPPRGSLGDGKEQEACVQ | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CBX2 chromobox homolog 2 (Pc class homolog, Drosophila) [ Homo sapiens ] | 
| Official Symbol | CBX2 | 
| Synonyms | CBX2; chromobox homolog 2 (Pc class homolog, Drosophila); CDCA6, cell division cycle associated 6, chromobox homolog 2 (Drosophila Pc class); MGC10561; Pc class homolog (Drosophila); M33; CDCA6; | 
| Gene ID | 84733 | 
| mRNA Refseq | NM_005189 | 
| Protein Refseq | NP_005180 | 
| MIM | 602770 | 
| UniProt ID | Q14781 | 
| ◆ Recombinant Proteins | ||
| CBX2-2779HF | Recombinant Full Length Human CBX2 Protein, GST-tagged | +Inquiry | 
| CBX2-1271M | Recombinant Mouse CBX2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CBX2-10767H | Recombinant Human CBX2, His-tagged | +Inquiry | 
| CBX2-0479H | Recombinant Human CBX2 Protein, GST-Tagged | +Inquiry | 
| CBX2-2792M | Recombinant Mouse CBX2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CBX2-7806HCL | Recombinant Human CBX2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBX2 Products
Required fields are marked with *
My Review for All CBX2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            