Recombinant Human CBX5 protein, T7/His-tagged

• Cat.No.: CBX5-154H
• Product Overview: Recombinant human CBX5 cDNA (190 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEE HNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLE PEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: CBX5 chromobox homolog 5 [ Homo sapiens ]
• Official Symbol: CBX5
• Synonyms: CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha) , chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha; HP1-ALPHA; antigen p25; HP1 alpha homolog; heterochromatin protein 1-alpha; heterochromatin protein 1 homolog alpha; chromobox homolog 5 (HP1 alpha homolog, Drosophila); HP1A
• Gene ID: 23468
• mRNA Refseq: NM_001127321
• Protein Refseq: NP_001120793
• MIM: 604478
• UniProt ID: P45973
• Chromosome Location: 12q13.13
• Pathway: Aurora B signaling, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem
• Function: chromatin binding; enzyme binding; histone deacetylase binding; methylated histone residue binding; protein binding; protein binding, bridging; repressing transcription factor binding