Recombinant Human CBX6 Protein, GST-Tagged
Cat.No. : | CBX6-0484H |
Product Overview : | Human CBX6 full-length ORF (AAH12111.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CBX6 (Chromobox 6) is a Protein Coding gene. Among its related pathways are Cellular Senescence. GO annotations related to this gene include single-stranded RNA binding. An important paralog of this gene is CBX8. |
Molecular Mass : | 70.3 kDa |
AA Sequence : | MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTLPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CBX6 chromobox homolog 6 [ Homo sapiens ] |
Official Symbol | CBX6 |
Synonyms | CBX6; chromobox homolog 6; chromobox protein homolog 6; |
Gene ID | 23466 |
mRNA Refseq | NM_014292 |
Protein Refseq | NP_055107 |
MIM | 617438 |
UniProt ID | O95503 |
◆ Recombinant Proteins | ||
CBX6-1273M | Recombinant Mouse CBX6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBX6-2796M | Recombinant Mouse CBX6 Protein | +Inquiry |
CBX6-2782HF | Recombinant Full Length Human CBX6 Protein, GST-tagged | +Inquiry |
CBX6-0484H | Recombinant Human CBX6 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBX6-290HCL | Recombinant Human CBX6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBX6 Products
Required fields are marked with *
My Review for All CBX6 Products
Required fields are marked with *
0
Inquiry Basket