Recombinant Human CBX6 Protein, GST-Tagged

Cat.No. : CBX6-0484H
Product Overview : Human CBX6 full-length ORF (AAH12111.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CBX6 (Chromobox 6) is a Protein Coding gene. Among its related pathways are Cellular Senescence. GO annotations related to this gene include single-stranded RNA binding. An important paralog of this gene is CBX8.
Molecular Mass : 70.3 kDa
AA Sequence : MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTLPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CBX6 chromobox homolog 6 [ Homo sapiens ]
Official Symbol CBX6
Synonyms CBX6; chromobox homolog 6; chromobox protein homolog 6;
Gene ID 23466
mRNA Refseq NM_014292
Protein Refseq NP_055107
MIM 617438
UniProt ID O95503

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBX6 Products

Required fields are marked with *

My Review for All CBX6 Products

Required fields are marked with *

0
cart-icon
0
compare icon