Recombinant Human CBX7 Protein (1-251 aa), His-tagged
Cat.No. : | CBX7-1353H |
Product Overview : | Recombinant Human CBX7 Protein (1-251 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-251 aa |
Description : | Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin rodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 30.3 kDa |
AA Sequence : | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | CBX7 chromobox homolog 7 [ Homo sapiens ] |
Official Symbol | CBX7 |
Synonyms | CBX7; chromobox homolog 7; |
Gene ID | 23492 |
mRNA Refseq | NM_175709 |
Protein Refseq | NP_783640 |
MIM | 608457 |
UniProt ID | O95931 |
◆ Recombinant Proteins | ||
CBX7-2797M | Recombinant Mouse CBX7 Protein | +Inquiry |
CBX7-2783HF | Recombinant Full Length Human CBX7 Protein, GST-tagged | +Inquiry |
CBX7-649R | Recombinant Rhesus monkey CBX7 Protein, His-tagged | +Inquiry |
CBX7-0485H | Recombinant Human CBX7 Protein, GST-Tagged | +Inquiry |
CBX7-477R | Recombinant Rhesus Macaque CBX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBX7-7801HCL | Recombinant Human CBX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBX7 Products
Required fields are marked with *
My Review for All CBX7 Products
Required fields are marked with *
0
Inquiry Basket