Recombinant Human CBX7 Protein, GST-Tagged

Cat.No. : CBX7-0485H
Product Overview : Human CBX7 full-length ORF (NP_783640.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided by RefSeq, Oct 2016]
Molecular Mass : 54.7 kDa
AA Sequence : MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CBX7 chromobox homolog 7 [ Homo sapiens ]
Official Symbol CBX7
Synonyms CBX7; chromobox homolog 7; chromobox protein homolog 7;
Gene ID 23492
mRNA Refseq NM_175709
Protein Refseq NP_783640
MIM 608457
UniProt ID O95931

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBX7 Products

Required fields are marked with *

My Review for All CBX7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon