Recombinant Human CBX7 Protein, GST-Tagged
| Cat.No. : | CBX7-0485H | 
| Product Overview : | Human CBX7 full-length ORF (NP_783640.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided by RefSeq, Oct 2016] | 
| Molecular Mass : | 54.7 kDa | 
| AA Sequence : | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CBX7 chromobox homolog 7 [ Homo sapiens ] | 
| Official Symbol | CBX7 | 
| Synonyms | CBX7; chromobox homolog 7; chromobox protein homolog 7; | 
| Gene ID | 23492 | 
| mRNA Refseq | NM_175709 | 
| Protein Refseq | NP_783640 | 
| MIM | 608457 | 
| UniProt ID | O95931 | 
| ◆ Recombinant Proteins | ||
| CBX7-0485H | Recombinant Human CBX7 Protein, GST-Tagged | +Inquiry | 
| CBX7-649R | Recombinant Rhesus monkey CBX7 Protein, His-tagged | +Inquiry | 
| CBX7-821R | Recombinant Rat CBX7 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CBX7-477R | Recombinant Rhesus Macaque CBX7 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CBX7-2783HF | Recombinant Full Length Human CBX7 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CBX7-7801HCL | Recombinant Human CBX7 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBX7 Products
Required fields are marked with *
My Review for All CBX7 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            