Recombinant Human CC2D2B Protein, GST-Tagged
Cat.No. : | CC2D2B-0490H |
Product Overview : | Human CC2D2B full-length ORF (ENSP00000343747, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CC2D2B (Coiled-Coil And C2 Domain Containing 2B) is a Protein Coding gene. Diseases associated with CC2D2B include Meckel Syndrome 1 and Joubert Syndrome 1. An important paralog of this gene is CC2D2A. |
Molecular Mass : | 56.5 kDa |
AA Sequence : | MFPNRRIVTTVFNDEGIQFLVTRYIKALNPPQQLLDIFLHNSNATFDLIARFVSLIPFVPNTPDENDGSDIWMTSEHCISLAIGNKEEHAILLCNFFLYFGKKALVLLGTSVLEGHVAYVVTQETNEYLLWNPSTGQCYKQFDPFCPLKSVDCLFDDRNVWFNIQQNNTPMAVFFDYSKESFWKQLLPKNVQGTKIQSIQVTGFPIQMPYIDVQSIIDAVYQTGIHSAEFPQTEFALAVYIHPYPNNILSVWVYLASLVQHQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CC2D2B coiled-coil and C2 domain containing 2B [ Homo sapiens ] |
Official Symbol | CC2D2B |
Synonyms | C10orf130; bA248J23.4 |
Gene ID | 387707 |
mRNA Refseq | NM_001159747 |
Protein Refseq | NP_001153219 |
UniProt ID | Q6DHV5 |
◆ Recombinant Proteins | ||
CC2D2B-2790HF | Recombinant Full Length Human CC2D2B Protein, GST-tagged | +Inquiry |
CC2D2B-0490H | Recombinant Human CC2D2B Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CC2D2B Products
Required fields are marked with *
My Review for All CC2D2B Products
Required fields are marked with *
0
Inquiry Basket