Recombinant Human CCDC106 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: CCDC106-276H
• Product Overview: CCDC106 MS Standard C13 and N15-labeled recombinant protein (NP_037433) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Promotes the degradation of p53/TP53 protein and inhibits its transactivity.
• Molecular Mass: 32 kDa
• AA Sequence: MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CCDC106 coiled-coil domain containing 106 [ Homo sapiens (human) ]
• Official Symbol: CCDC106
• Synonyms: CCDC106; coiled-coil domain containing 106; coiled-coil domain-containing protein 106; HSU79303; protein predicted by clone 23882; ZNF581
• Gene ID: 29903
• mRNA Refseq: NM_013301
• Protein Refseq: NP_037433
• MIM: 613478
• UniProt ID: Q9BWC9