Recombinant Human CCDC106 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CCDC106-276H |
Product Overview : | CCDC106 MS Standard C13 and N15-labeled recombinant protein (NP_037433) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Promotes the degradation of p53/TP53 protein and inhibits its transactivity. |
Molecular Mass : | 32 kDa |
AA Sequence : | MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CCDC106 coiled-coil domain containing 106 [ Homo sapiens (human) ] |
Official Symbol | CCDC106 |
Synonyms | CCDC106; coiled-coil domain containing 106; coiled-coil domain-containing protein 106; HSU79303; protein predicted by clone 23882; ZNF581; |
Gene ID | 29903 |
mRNA Refseq | NM_013301 |
Protein Refseq | NP_037433 |
MIM | 613478 |
UniProt ID | Q9BWC9 |
◆ Recombinant Proteins | ||
CCDC106-482R | Recombinant Rhesus Macaque CCDC106 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC106-1284M | Recombinant Mouse CCDC106 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccdc106-1983M | Recombinant Mouse Ccdc106 Protein, Myc/DDK-tagged | +Inquiry |
CCDC106-276H | Recombinant Human CCDC106 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCDC106-2815HF | Recombinant Full Length Human CCDC106 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC106-7791HCL | Recombinant Human CCDC106 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC106 Products
Required fields are marked with *
My Review for All CCDC106 Products
Required fields are marked with *
0
Inquiry Basket