Recombinant Human CCDC106 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CCDC106-276H |
| Product Overview : | CCDC106 MS Standard C13 and N15-labeled recombinant protein (NP_037433) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Promotes the degradation of p53/TP53 protein and inhibits its transactivity. |
| Molecular Mass : | 32 kDa |
| AA Sequence : | MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CCDC106 coiled-coil domain containing 106 [ Homo sapiens (human) ] |
| Official Symbol | CCDC106 |
| Synonyms | CCDC106; coiled-coil domain containing 106; coiled-coil domain-containing protein 106; HSU79303; protein predicted by clone 23882; ZNF581; |
| Gene ID | 29903 |
| mRNA Refseq | NM_013301 |
| Protein Refseq | NP_037433 |
| MIM | 613478 |
| UniProt ID | Q9BWC9 |
| ◆ Recombinant Proteins | ||
| CCDC106-0505H | Recombinant Human CCDC106 Protein, GST-Tagged | +Inquiry |
| CCDC106-2810M | Recombinant Mouse CCDC106 Protein | +Inquiry |
| CCDC106-654R | Recombinant Rhesus monkey CCDC106 Protein, His-tagged | +Inquiry |
| CCDC106-2815HF | Recombinant Full Length Human CCDC106 Protein, GST-tagged | +Inquiry |
| Ccdc106-1983M | Recombinant Mouse Ccdc106 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC106-7791HCL | Recombinant Human CCDC106 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC106 Products
Required fields are marked with *
My Review for All CCDC106 Products
Required fields are marked with *
