Recombinant Human CCDC107 Protein, GST-Tagged
Cat.No. : | CCDC107-0506H |
Product Overview : | Human CCDC107 full-length ORF (AAH18758.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013] |
Molecular Mass : | 57.53 kDa |
AA Sequence : | MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTTLAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPEDFCLKEDEEEVGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQSLFS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC107 coiled-coil domain containing 107 [ Homo sapiens ] |
Official Symbol | CCDC107 |
Synonyms | PSEC0222; RP11-331F9.6 |
Gene ID | 203260 |
mRNA Refseq | NM_174923 |
Protein Refseq | NP_777583 |
UniProt ID | Q8WV48 |
◆ Recombinant Proteins | ||
CCDC107-0506H | Recombinant Human CCDC107 Protein, GST-Tagged | +Inquiry |
CCDC107-2770H | Recombinant Human CCDC107 Protein, MYC/DDK-tagged | +Inquiry |
RFL35822HF | Recombinant Full Length Human Coiled-Coil Domain-Containing Protein 107(Ccdc107) Protein, His-Tagged | +Inquiry |
CCDC107-4446H | Recombinant Human CCDC107 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ccdc107-1285M | Recombinant Mouse Ccdc107 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC107-148HCL | Recombinant Human CCDC107 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC107 Products
Required fields are marked with *
My Review for All CCDC107 Products
Required fields are marked with *