Recombinant Human CCDC107 Protein, GST-Tagged
| Cat.No. : | CCDC107-0506H |
| Product Overview : | Human CCDC107 full-length ORF (AAH18758.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013] |
| Molecular Mass : | 57.53 kDa |
| AA Sequence : | MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTTLAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPEDFCLKEDEEEVGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQSLFS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC107 coiled-coil domain containing 107 [ Homo sapiens ] |
| Official Symbol | CCDC107 |
| Synonyms | PSEC0222; RP11-331F9.6 |
| Gene ID | 203260 |
| mRNA Refseq | NM_174923 |
| Protein Refseq | NP_777583 |
| UniProt ID | Q8WV48 |
| ◆ Recombinant Proteins | ||
| CCDC107-0506H | Recombinant Human CCDC107 Protein, GST-Tagged | +Inquiry |
| Ccdc107-1285M | Recombinant Mouse Ccdc107 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ccdc107-2811M | Recombinant Mouse Ccdc107 Protein | +Inquiry |
| CCDC107-2770H | Recombinant Human CCDC107 Protein, MYC/DDK-tagged | +Inquiry |
| CCDC107-4446H | Recombinant Human CCDC107 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC107-148HCL | Recombinant Human CCDC107 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC107 Products
Required fields are marked with *
My Review for All CCDC107 Products
Required fields are marked with *
