Recombinant Human CCDC113 Protein, GST-tagged
| Cat.No. : | CCDC113-5156H |
| Product Overview : | Human CCDC113 full-length ORF ( NP_054876.2, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CCDC113 (Coiled-Coil Domain Containing 113) is a Protein Coding gene. |
| Molecular Mass : | 70.6 kDa |
| AA Sequence : | MTDDESESVLSDSHEGSELELPVIQLCGLVEELSYVNSALKTETEMFEKYYAKLEPRDQRPPRLSEIKISAADYAQFRGRRRSKSRTGMDRGVGLTADQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRWSEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQKEEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILLRKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEMSLKGHRKAWNRMKITNEQLQADYLAGK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC113 coiled-coil domain containing 113 [ Homo sapiens (human) ] |
| Official Symbol | CCDC113 |
| Synonyms | CCDC113; coiled-coil domain containing 113; HSPC065; coiled-coil domain-containing protein 113 |
| Gene ID | 29070 |
| mRNA Refseq | NM_001142302 |
| Protein Refseq | NP_001135774 |
| MIM | 616070 |
| UniProt ID | Q9H0I3 |
| ◆ Recombinant Proteins | ||
| CCDC113-1571Z | Recombinant Zebrafish CCDC113 | +Inquiry |
| CCDC113-2819M | Recombinant Mouse CCDC113 Protein | +Inquiry |
| CCDC113-1292M | Recombinant Mouse CCDC113 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCDC113-5156H | Recombinant Human CCDC113 Protein, GST-tagged | +Inquiry |
| CCDC113-3790HF | Recombinant Full Length Human CCDC113 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC113 Products
Required fields are marked with *
My Review for All CCDC113 Products
Required fields are marked with *
