Recombinant Human CCDC132 protein, His-tagged
| Cat.No. : | CCDC132-2985H |
| Product Overview : | Recombinant Human CCDC132 protein(337 - 693 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 337 - 693 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | EWHEKHDNEDTASASEGSNMIGTEETNFDRGYIKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIISRLMQVGEEFCGSKSEVLQESIRKQSVNYFKNYHRTRLDELRMFLENETWELCPVKSNFSILQLHEFKFMEQSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLN |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CCDC132 coiled-coil domain containing 132 [ Homo sapiens ] |
| Official Symbol | CCDC132 |
| Synonyms | CCDC132; coiled-coil domain containing 132; coiled-coil domain-containing protein 132; DKFZp313I2429; FLJ20097; KIAA1861; FLJ23581; MGC176659; |
| Gene ID | 55610 |
| mRNA Refseq | NM_001257998 |
| Protein Refseq | NP_001244927 |
| UniProt ID | Q96JG6 |
| ◆ Recombinant Proteins | ||
| CCDC132-2073C | Recombinant Chicken CCDC132 | +Inquiry |
| CCDC132-2985H | Recombinant Human CCDC132 protein, His-tagged | +Inquiry |
| CCDC132-2836M | Recombinant Mouse CCDC132 Protein | +Inquiry |
| CCDC132-1306M | Recombinant Mouse CCDC132 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC132-153HCL | Recombinant Human CCDC132 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC132 Products
Required fields are marked with *
My Review for All CCDC132 Products
Required fields are marked with *
