Recombinant Human CCDC137 Protein, GST-tagged
Cat.No. : | CCDC137-5250H |
Product Overview : | Human CCDC137 full-length ORF ( AAH09369.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CCDC137 (Coiled-Coil Domain Containing 137) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. |
Molecular Mass : | 59.6 kDa |
AA Sequence : | MAGAGRGAAVSRVQAGPGSPRRARGRQQVQPLGKQRPAPWPGLRSKEKKKVNCKPKNQDEQEIPFRLREIMRSRQEMKNPISNKKRKKAAQVTFRKTLEKEAKGEEPDIAVPKFKQRKGESDGAYIHRMQQEAQHVLFLSKNQAIRQPEVQAAPKEKSEQKKAKKAFQKRRLDKVRRKKEEKAADRLEQELLRDTVKFGEVVLQPPELTARPQRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC137 coiled-coil domain containing 137 [ Homo sapiens (human) ] |
Official Symbol | CCDC137 |
Synonyms | CCDC137; coiled-coil domain containing 137; RaRF; coiled-coil domain-containing protein 137; hepatocellular carcinoma related protein 2; retinoic acid resistance factor |
Gene ID | 339230 |
mRNA Refseq | NM_199287 |
Protein Refseq | NP_954981 |
MIM | 614271 |
UniProt ID | Q6PK04 |
◆ Recombinant Proteins | ||
CCDC137-4586Z | Recombinant Zebrafish CCDC137 | +Inquiry |
CCDC137-5250H | Recombinant Human CCDC137 Protein, GST-tagged | +Inquiry |
CCDC137-3909HF | Recombinant Full Length Human CCDC137 Protein, GST-tagged | +Inquiry |
CCDC137-1309M | Recombinant Mouse CCDC137 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC137-2840M | Recombinant Mouse CCDC137 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC137-154HCL | Recombinant Human CCDC137 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC137 Products
Required fields are marked with *
My Review for All CCDC137 Products
Required fields are marked with *