Recombinant Human CCDC137 Protein, GST-tagged

• Cat.No.: CCDC137-5250H
• Product Overview: Human CCDC137 full-length ORF ( AAH09369.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CCDC137 (Coiled-Coil Domain Containing 137) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding.
• Molecular Mass: 59.6 kDa
• AA Sequence: MAGAGRGAAVSRVQAGPGSPRRARGRQQVQPLGKQRPAPWPGLRSKEKKKVNCKPKNQDEQEIPFRLREIMRSRQEMKNPISNKKRKKAAQVTFRKTLEKEAKGEEPDIAVPKFKQRKGESDGAYIHRMQQEAQHVLFLSKNQAIRQPEVQAAPKEKSEQKKAKKAFQKRRLDKVRRKKEEKAADRLEQELLRDTVKFGEVVLQPPELTARPQRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC137 coiled-coil domain containing 137 [ Homo sapiens (human) ]
• Official Symbol: CCDC137
• Synonyms: CCDC137; coiled-coil domain containing 137; RaRF; coiled-coil domain-containing protein 137; hepatocellular carcinoma related protein 2; retinoic acid resistance factor
• Gene ID: 339230
• mRNA Refseq: NM_199287
• Protein Refseq: NP_954981
• MIM: 614271
• UniProt ID: Q6PK04