Recombinant Human CCDC137 Protein, GST-tagged

Cat.No. : CCDC137-5250H
Product Overview : Human CCDC137 full-length ORF ( AAH09369.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CCDC137 (Coiled-Coil Domain Containing 137) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding.
Molecular Mass : 59.6 kDa
AA Sequence : MAGAGRGAAVSRVQAGPGSPRRARGRQQVQPLGKQRPAPWPGLRSKEKKKVNCKPKNQDEQEIPFRLREIMRSRQEMKNPISNKKRKKAAQVTFRKTLEKEAKGEEPDIAVPKFKQRKGESDGAYIHRMQQEAQHVLFLSKNQAIRQPEVQAAPKEKSEQKKAKKAFQKRRLDKVRRKKEEKAADRLEQELLRDTVKFGEVVLQPPELTARPQRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC137 coiled-coil domain containing 137 [ Homo sapiens (human) ]
Official Symbol CCDC137
Synonyms CCDC137; coiled-coil domain containing 137; RaRF; coiled-coil domain-containing protein 137; hepatocellular carcinoma related protein 2; retinoic acid resistance factor
Gene ID 339230
mRNA Refseq NM_199287
Protein Refseq NP_954981
MIM 614271
UniProt ID Q6PK04

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC137 Products

Required fields are marked with *

My Review for All CCDC137 Products

Required fields are marked with *

0
cart-icon