Recombinant Human CCDC155 protein, His-tagged
| Cat.No. : | CCDC155-2471H |
| Product Overview : | Recombinant Human CCDC155 protein(1-349 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-349 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDLPEGPVGGPTAEMYLRERPEEARLGMPVSLEEQILNSTFEACDPQRTGTVAVAQVLAYLEAVTGQGPQDARLQTLANSLDPNGEGPKATVDLDTFLVVMRDWIAACQLHGGLELEEETAFQGALTSQQLPSGCPEAEEPANLESFGGEDPRPELQATADLLSSLEDLELSNRRLVGENAKLQRSMETAEEGSARLGEEILALRKQLHSTQQALQFAKAMDEELEDLKTLARSLEEQNRSLLAQARQAEKEQQHLVAEMETLQEENGKLLAERDGVKKRSQELAMEKDTLKRQLFECEHLICQRDTILSERTRDVESLAQTLEEYRVTTQELRLEISRLEEQLSQTYE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CCDC155 coiled-coil domain containing 155 [ Homo sapiens ] |
| Official Symbol | CCDC155 |
| Synonyms | CCDC155; coiled-coil domain containing 155; coiled-coil domain-containing protein 155; FLJ32658; DKFZp434A2223; |
| Gene ID | 147872 |
| mRNA Refseq | NM_144688 |
| Protein Refseq | NP_653289 |
| UniProt ID | Q8N6L0 |
| ◆ Recombinant Proteins | ||
| CCDC155-4305H | Recombinant Human CCDC155 Protein, GST-tagged | +Inquiry |
| CCDC155-2471H | Recombinant Human CCDC155 protein, His-tagged | +Inquiry |
| CCDC155-4997HF | Recombinant Full Length Human CCDC155 Protein, GST-tagged | +Inquiry |
| CCDC155-2759H | Recombinant Human CCDC155 Protein, MYC/DDK-tagged | +Inquiry |
| CCDC155-301168H | Recombinant Human CCDC155 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC155-643HCL | Recombinant Human CCDC155 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC155 Products
Required fields are marked with *
My Review for All CCDC155 Products
Required fields are marked with *
