Recombinant Human CCDC25 Protein, GST-Tagged
Cat.No. : | CCDC25-0540H |
Product Overview : | Human CCDC25 full-length ORF (AAH32588.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CCDC25 (Coiled-Coil Domain Containing 25) is a Protein Coding gene. |
Molecular Mass : | 42.9 kDa |
AA Sequence : | MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC25 coiled-coil domain containing 25 [ Homo sapiens ] |
Official Symbol | CCDC25 |
Synonyms | CCDC25; coiled-coil domain containing 25; coiled-coil domain-containing protein 25; FLJ10853; |
Gene ID | 55246 |
mRNA Refseq | NM_018246 |
Protein Refseq | NP_060716 |
UniProt ID | Q86WR0 |
◆ Recombinant Proteins | ||
CCDC25-10703Z | Recombinant Zebrafish CCDC25 | +Inquiry |
CCDC25-664R | Recombinant Rhesus monkey CCDC25 Protein, His-tagged | +Inquiry |
CCDC25-0540H | Recombinant Human CCDC25 Protein, GST-Tagged | +Inquiry |
CCDC25-492R | Recombinant Rhesus Macaque CCDC25 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC25-10796H | Recombinant Human CCDC25, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC25-7770HCL | Recombinant Human CCDC25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC25 Products
Required fields are marked with *
My Review for All CCDC25 Products
Required fields are marked with *