Recombinant Full Length Human CCDC25 Protein, GST-tagged
| Cat.No. : | CCDC25-2850HF | 
| Product Overview : | Human CCDC25 full-length ORF (AAH32588.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 140 amino acids | 
| Description : | CCDC25 (Coiled-Coil Domain Containing 25) is a Protein Coding gene. | 
| Molecular Mass : | 42.9 kDa | 
| AA Sequence : | MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CCDC25 coiled-coil domain containing 25 [ Homo sapiens ] | 
| Official Symbol | CCDC25 | 
| Synonyms | CCDC25; coiled-coil domain containing 25; coiled-coil domain-containing protein 25; FLJ10853; | 
| Gene ID | 55246 | 
| mRNA Refseq | NM_018246 | 
| Protein Refseq | NP_060716 | 
| MIM | 619100 | 
| UniProt ID | Q86WR0 | 
| ◆ Recombinant Proteins | ||
| CCDC25-2850HF | Recombinant Full Length Human CCDC25 Protein, GST-tagged | +Inquiry | 
| CCDC25-10703Z | Recombinant Zebrafish CCDC25 | +Inquiry | 
| CCDC25-664R | Recombinant Rhesus monkey CCDC25 Protein, His-tagged | +Inquiry | 
| Ccdc25-2002M | Recombinant Mouse Ccdc25 Protein, Myc/DDK-tagged | +Inquiry | 
| CCDC25-10796H | Recombinant Human CCDC25, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CCDC25-7770HCL | Recombinant Human CCDC25 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC25 Products
Required fields are marked with *
My Review for All CCDC25 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            