Recombinant Full Length Human CCDC25 Protein, GST-tagged
| Cat.No. : | CCDC25-2850HF |
| Product Overview : | Human CCDC25 full-length ORF (AAH32588.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 140 amino acids |
| Description : | CCDC25 (Coiled-Coil Domain Containing 25) is a Protein Coding gene. |
| Molecular Mass : | 42.9 kDa |
| AA Sequence : | MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC25 coiled-coil domain containing 25 [ Homo sapiens ] |
| Official Symbol | CCDC25 |
| Synonyms | CCDC25; coiled-coil domain containing 25; coiled-coil domain-containing protein 25; FLJ10853; |
| Gene ID | 55246 |
| mRNA Refseq | NM_018246 |
| Protein Refseq | NP_060716 |
| MIM | 619100 |
| UniProt ID | Q86WR0 |
| ◆ Recombinant Proteins | ||
| CCDC25-2850HF | Recombinant Full Length Human CCDC25 Protein, GST-tagged | +Inquiry |
| CCDC25-0540H | Recombinant Human CCDC25 Protein, GST-Tagged | +Inquiry |
| CCDC25-15912H | Recombinant Human CCDC25, His-tagged | +Inquiry |
| Ccdc25-2002M | Recombinant Mouse Ccdc25 Protein, Myc/DDK-tagged | +Inquiry |
| CCDC25-10796H | Recombinant Human CCDC25, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC25-7770HCL | Recombinant Human CCDC25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC25 Products
Required fields are marked with *
My Review for All CCDC25 Products
Required fields are marked with *
