Recombinant Human CCDC53 protein, GST-tagged
| Cat.No. : | CCDC53-301180H |
| Product Overview : | Recombinant Human CCDC53 (1-194 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Asp194 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQSSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | CCDC53 coiled-coil domain containing 53 [ Homo sapiens ] |
| Official Symbol | CCDC53 |
| Synonyms | CGI-116 |
| Gene ID | 51019 |
| mRNA Refseq | NM_016053.2 |
| Protein Refseq | NP_057137.1 |
| UniProt ID | Q9Y3C0 |
| ◆ Recombinant Proteins | ||
| CCDC53-1344M | Recombinant Mouse CCDC53 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCDC53-301180H | Recombinant Human CCDC53 protein, GST-tagged | +Inquiry |
| CCDC53-10519Z | Recombinant Zebrafish CCDC53 | +Inquiry |
| CCDC53-2903M | Recombinant Mouse CCDC53 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC53-7761HCL | Recombinant Human CCDC53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC53 Products
Required fields are marked with *
My Review for All CCDC53 Products
Required fields are marked with *
