Recombinant Human CCDC85B Protein, GST-tagged
Cat.No. : | CCDC85B-2633H |
Product Overview : | Human DIPA partial ORF ( NP_006839.2, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Hepatitis delta virus (HDV) is a pathogenic human virus whose RNA genome and replication cycle resemble those of plant viroids. Delta-interacting protein A (DIPA), a cellular gene product, has been found to have homology to hepatitis delta virus antigen (HDAg). DIPA interacts with the viral antigen, HDAg, and can affect HDV replication in vitro. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC85B coiled-coil domain containing 85B [ Homo sapiens ] |
Official Symbol | CCDC85B |
Synonyms | CCDC85B; coiled-coil domain containing 85B; coiled-coil domain-containing protein 85B; DIPA; hepatitis delta antigen interacting protein A; delta-interacting protein A; hepatitis delta antigen-interacting protein A; |
Gene ID | 11007 |
mRNA Refseq | NM_006848 |
Protein Refseq | NP_006839 |
MIM | 605360 |
UniProt ID | Q15834 |
◆ Recombinant Proteins | ||
CCDC85B-500R | Recombinant Rhesus Macaque CCDC85B Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC85B-7593Z | Recombinant Zebrafish CCDC85B | +Inquiry |
CCDC85B-672R | Recombinant Rhesus monkey CCDC85B Protein, His-tagged | +Inquiry |
CCDC85B-2633H | Recombinant Human CCDC85B Protein, GST-tagged | +Inquiry |
CCDC85B-10820H | Recombinant Human CCDC85B, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC85B-161HCL | Recombinant Human CCDC85B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC85B Products
Required fields are marked with *
My Review for All CCDC85B Products
Required fields are marked with *