Recombinant Human CCDC90B protein, His-tagged
Cat.No. : | CCDC90B-2750H |
Product Overview : | Recombinant Human CCDC90B protein(146 - 246 aa), fused to His tag, was expressed in E. coli. |
Availability | June 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 146 - 246 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CCDC90B coiled-coil domain containing 90B [ Homo sapiens ] |
Official Symbol | CCDC90B |
Synonyms | CCDC90B; coiled-coil domain containing 90B; coiled-coil domain-containing protein 90B, mitochondrial; MDS011; MDS025; MGC104239; |
Gene ID | 60492 |
mRNA Refseq | NM_021825 |
Protein Refseq | NP_068597 |
UniProt ID | Q9GZT6 |
◆ Recombinant Proteins | ||
CCDC90B-674R | Recombinant Rhesus monkey CCDC90B Protein, His-tagged | +Inquiry |
RFL12463MF | Recombinant Full Length Mouse Coiled-Coil Domain-Containing Protein 90B, Mitochondrial(Ccdc90B) Protein, His-Tagged | +Inquiry |
CCDC90B-2866H | Recombinant Human CCDC90B Protein, MYC/DDK-tagged | +Inquiry |
CCDC90B-0592H | Recombinant Human CCDC90B Protein, GST-Tagged | +Inquiry |
CCDC90B-1381M | Recombinant Mouse CCDC90B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC90B-163HCL | Recombinant Human CCDC90B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC90B Products
Required fields are marked with *
My Review for All CCDC90B Products
Required fields are marked with *
0
Inquiry Basket