Recombinant Human CCKBR protein, GST-tagged
Cat.No. : | CCKBR-26H |
Product Overview : | Recombinant Human CCKBR(215 a.a. - 327 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 215-327 a.a. |
Description : | This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCKanalogs and is found principally in the central nervous system and the gastrointestinal tract. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.06 kDa |
AA Sequence : | RQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGED SDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CCKBR cholecystokinin B receptor [ Homo sapiens ] |
Official Symbol | CCKBR |
Synonyms | CCKBR; cholecystokinin B receptor; gastrin/cholecystokinin type B receptor; CCK-BR; CCK2-R; CCK2 receptor; CCK-B receptor; gastrin receptor; cholecystokinin-2 receptor; GASR; CCK-B; CCK2R; |
Gene ID | 887 |
mRNA Refseq | NM_176875 |
Protein Refseq | NP_795344 |
MIM | 118445 |
UniProt ID | P32239 |
Chromosome Location | 11p15.4 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function | 1-phosphatidylinositol-3-kinase regulator activity; G-protein coupled receptor activity; cholecystokinin receptor activity; gastrin receptor activity; phosphatidylinositol phospholipase C activity; receptor activity; signal transducer activity; type B gastrin/cholecystokinin receptor binding; |
◆ Recombinant Proteins | ||
CCKBR-1475M | Recombinant Mouse CCKBR protein, Fc-tagged | +Inquiry |
CCKBR-1476H | Recombinant Human CCKBR protein, Fc-tagged | +Inquiry |
CCKBR-2957M | Recombinant Mouse CCKBR Protein | +Inquiry |
CCKBR-1138C | Recombinant Chicken CCKBR | +Inquiry |
RFL35140RF | Recombinant Full Length Rat Gastrin/Cholecystokinin Type B Receptor(Cckbr) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCKBR-168HCL | Recombinant Human CCKBR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCKBR Products
Required fields are marked with *
My Review for All CCKBR Products
Required fields are marked with *