Recombinant Human CCKBR protein, His-tagged
Cat.No. : | CCKBR-9675H |
Product Overview : | Recombinant Human CCKBR protein(243-333 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 243-333 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | RELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVR |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CCKBR cholecystokinin B receptor [ Homo sapiens ] |
Official Symbol | CCKBR |
Synonyms | CCKBR; cholecystokinin B receptor; gastrin/cholecystokinin type B receptor; CCK-BR; CCK2-R; CCK2 receptor; CCK-B receptor; gastrin receptor; cholecystokinin-2 receptor; GASR; CCK-B; CCK2R; |
Gene ID | 887 |
mRNA Refseq | NM_176875 |
Protein Refseq | NP_795344 |
MIM | 118445 |
UniProt ID | P32239 |
◆ Recombinant Proteins | ||
RFL35140RF | Recombinant Full Length Rat Gastrin/Cholecystokinin Type B Receptor(Cckbr) Protein, His-Tagged | +Inquiry |
CCKBR-1209R | Recombinant Rat CCKBR Protein | +Inquiry |
CCKBR-2957M | Recombinant Mouse CCKBR Protein | +Inquiry |
CCKBR-1475M | Recombinant Mouse CCKBR protein, Fc-tagged | +Inquiry |
RFL29424MF | Recombinant Full Length Mouse Gastrin/Cholecystokinin Type B Receptor(Cckbr) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCKBR-168HCL | Recombinant Human CCKBR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCKBR Products
Required fields are marked with *
My Review for All CCKBR Products
Required fields are marked with *