Recombinant Human CCL1 protein
Cat.No. : | CCL1-605H |
Product Overview : | Recombinant Human CCL1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 74 |
Description : | Chemokine (C-C motif) ligand 1 (CCL1) belongs to a family inflammatory cytokines and also known as chemokines. It is a small glycoprotein secreted by activated T cells with a molecular weight of approximately 8.5 kDa. CCL1 attracts monocytes, NK cells, and immature B cells and dendritic cells by interacting with a cell surface chemokine receptor called CCR8. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42 % amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 8.6 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : | SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Endotoxin : | Less than 1 EU/μg of rHuI-309/CCL1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL1 |
Official Symbol | CCL1 |
Synonyms | CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1; |
Gene ID | 6346 |
mRNA Refseq | NM_002981 |
Protein Refseq | NP_002972 |
MIM | 182281 |
UniProt ID | P22362 |
◆ Recombinant Proteins | ||
CCL1-266C | Active Recombinant Human CCL1 Protein (73 aa) | +Inquiry |
Ccl1-639M | Recombinant Mouse Ccl1 Protein, His-tagged | +Inquiry |
CCL1-77H | Recombinant Human CCL1 Protein, Biotin-tagged | +Inquiry |
Ccl1-638H | Recombinant Hamster Ccl1 Protein, His&GST-tagged | +Inquiry |
CCL1-214H | Recombinant Human CCL1 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL1-3060HCL | Recombinant Human CCL1 cell lysate | +Inquiry |
CCL1-1690MCL | Recombinant Mouse CCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL1 Products
Required fields are marked with *
My Review for All CCL1 Products
Required fields are marked with *
0
Inquiry Basket