Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
74 |
Description : |
Chemokine (C-C motif) ligand 1 (CCL1) belongs to a family inflammatory cytokines and also known as chemokines. It is a small glycoprotein secreted by activated T cells with a molecular weight of approximately 8.5 kDa. CCL1 attracts monocytes, NK cells, and immature B cells and dendritic cells by interacting with a cell surface chemokine receptor called CCR8. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42 % amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : |
Approximately 8.6 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : |
SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Endotoxin : |
Less than 1 EU/μg of rHuI-309/CCL1 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |