Recombinant Human CCL1 protein

• Cat.No.: CCL1-605H
• Product Overview: Recombinant Human CCL1 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 74
• Description: Chemokine (C-C motif) ligand 1 (CCL1) belongs to a family inflammatory cytokines and also known as chemokines. It is a small glycoprotein secreted by activated T cells with a molecular weight of approximately 8.5 kDa. CCL1 attracts monocytes, NK cells, and immature B cells and dendritic cells by interacting with a cell surface chemokine receptor called CCR8. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42 % amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml.
• Molecular Mass: Approximately 8.6 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids.
• AA Sequence: SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
• Endotoxin: Less than 1 EU/μg of rHuI-309/CCL1 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CCL1
• Official Symbol: CCL1
• Synonyms: CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1
• Gene ID: 6346
• mRNA Refseq: NM_002981
• Protein Refseq: NP_002972
• MIM: 182281
• UniProt ID: P22362