| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
72 |
| Description : |
Human CCL14 is belonging to the CC chemokine family. It has two isoforms, CCL14a (HCC-1) and CCL14b (HCC-3). The sequence of HCC-3 differs from HCC-1 as follow: 27-27 R→ QTGGKPKVVKIQLKLVG. CCL14 was first isolated from the hemofiltrate of human patients with chronic renal failure. CCL14 promotes chemotaxis of T lymphocytes, monocytes and eosinophils, and inhibits infection of M-tropic human immunodeficiency virus type 1 and is a ligand for CCR1, CCR3 and CCR5. CCL14 is expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations in plasma. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 5.0-20 ng/ml. |
| Molecular Mass : |
Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids. |
| AA Sequence : |
TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
| Endotoxin : |
Less than 1 EU/μg of rHuHCC-1/CCL14 as determined by LAL method. |
| Purity : |
>96% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |