Recombinant Human CCL14 Protein
Cat.No. : | CCL14-011H |
Product Overview : | Recombinant human CCL14 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 93 |
Description : | This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. |
Form : | Lyophilized |
AA Sequence : | MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Purity : | > 97% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered and lyophilized. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CCL14 chemokine (C-C motif) ligand 14 [ Homo sapiens (human) ] |
Official Symbol | CCL14 |
Synonyms | CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015; |
Gene ID | 6358 |
mRNA Refseq | NM_032962 |
Protein Refseq | NP_116738 |
MIM | 601392 |
UniProt ID | Q16627 |
◆ Recombinant Proteins | ||
CCL14-4374H | Recombinant Human CCL14 protein, His-SUMO-tagged | +Inquiry |
CCL14-81H | Recombinant Human CCL14 Protein, Biotin-tagged | +Inquiry |
CCL14-10836H | Recombinant Human CCL14, GST-tagged | +Inquiry |
CCL14-151H | Recombinant Human CCL14 Protein, His-tagged | +Inquiry |
CCL14-2922HF | Recombinant Full Length Human CCL14 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL14-7732HCL | Recombinant Human CCL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL14 Products
Required fields are marked with *
My Review for All CCL14 Products
Required fields are marked with *