Recombinant Human CCL14 protein, His-SUMO-tagged
Cat.No. : | CCL14-4374H |
Product Overview : | Recombinant Human CCL14 protein(Q16627)(20-93aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-93aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.7 kDa |
AA Sequence : | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CCL14 chemokine (C-C motif) ligand 14 [ Homo sapiens ] |
Official Symbol | CCL14 |
Synonyms | CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015; |
Gene ID | 6358 |
mRNA Refseq | NM_032962 |
Protein Refseq | NP_116738 |
MIM | 601392 |
UniProt ID | Q16627 |
◆ Recombinant Proteins | ||
CCL14-1173H | Recombinant Human CCL14 Protein (Thr20-Asn93), N-GST tagged | +Inquiry |
CCL14-1068H | Recombinant Human CCL14 protein, His-tagged | +Inquiry |
CCL14-1786H | Recombinant Human CCL14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL14-0609H | Recombinant Human CCL14 Protein, GST-Tagged | +Inquiry |
CCL14-1527H | Recombinant Human CCL14 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL14-7732HCL | Recombinant Human CCL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL14 Products
Required fields are marked with *
My Review for All CCL14 Products
Required fields are marked with *