Recombinant Human CCL14 protein, His-SUMO-tagged
| Cat.No. : | CCL14-4374H |
| Product Overview : | Recombinant Human CCL14 protein(Q16627)(20-93aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-93aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.7 kDa |
| AA Sequence : | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CCL14 chemokine (C-C motif) ligand 14 [ Homo sapiens ] |
| Official Symbol | CCL14 |
| Synonyms | CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015; |
| Gene ID | 6358 |
| mRNA Refseq | NM_032962 |
| Protein Refseq | NP_116738 |
| MIM | 601392 |
| UniProt ID | Q16627 |
| ◆ Recombinant Proteins | ||
| CCL14-1527H | Recombinant Human CCL14 protein, His & GST-tagged | +Inquiry |
| CCL14-1067H | Recombinant Human CCL14 protein, His-tagged | +Inquiry |
| CCL14-1309H | Recombinant Human CCL14 Protein (Thr20-Asn93), C-His tagged | +Inquiry |
| CCL14-151H | Recombinant Human CCL14 Protein, His-tagged | +Inquiry |
| CCL14-1786H | Recombinant Human CCL14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL14-7732HCL | Recombinant Human CCL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL14 Products
Required fields are marked with *
My Review for All CCL14 Products
Required fields are marked with *



