| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
97 amino acids |
| Description : |
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. |
| Molecular Weight : |
11.200kDa |
| Tissue specificity : |
Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones. |
| Biological activity : |
Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 1,000-10,000IU/mg. |
| Form : |
Lyophilised:It is recommended to reconstitute the lyophilized protein in sterile ultra pure water not less than 100μg/ml, which can then be further diluted into other aqueous solutions. |
| Purity : |
by SDS-PAGE |
| Storage buffer : |
pH: 7.40Constituents:0.88% Sodium chloride, 0.28% Sodium phosphate |
| Storage : |
Please see Notes section |
| Sequences of amino acids : |
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
| Sequence Similarities : |
Belongs to the intercrine beta (chemokine CC) family. |