Recombinant Human CCL16
Cat.No. : | CCL16-29941TH |
Product Overview : | Recombinant full length mature Human LEC, amino acids 24-120, predicted MW: 11.2kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 97 amino acids |
Description : | This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. |
Molecular Weight : | 11.200kDa |
Tissue specificity : | Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones. |
Biological activity : | Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 1,000-10,000IU/mg. |
Form : | Lyophilised:It is recommended to reconstitute the lyophilized protein in sterile ultra pure water not less than 100μg/ml, which can then be further diluted into other aqueous solutions. |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 7.40Constituents:0.88% Sodium chloride, 0.28% Sodium phosphate |
Storage : | Please see Notes section |
Sequences of amino acids : | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
Sequence Similarities : | Belongs to the intercrine beta (chemokine CC) family. |
Gene Name | CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ] |
Official Symbol | CCL16 |
Synonyms | CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; |
Gene ID | 6360 |
mRNA Refseq | NM_004590 |
Protein Refseq | NP_004581 |
MIM | 601394 |
Uniprot ID | O15467 |
Chromosome Location | 17q11.2 |
Pathway | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
Function | chemoattractant activity; chemokine activity; |
◆ Recombinant Proteins | ||
CCL16-29941TH | Recombinant Human CCL16 | +Inquiry |
CCL16-151H | Recombinant Human CCL16 Protein, His-tagged | +Inquiry |
CCL16-296H | Recombinant Human CCL16, StrepII-tagged | +Inquiry |
CCL16-0614H | Recombinant Human CCL16 protein, His-tagged | +Inquiry |
CCL16-1014H | Recombinant Human CCL16 Protein (Gln24-Gln120), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL16-7730HCL | Recombinant Human CCL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL16 Products
Required fields are marked with *
My Review for All CCL16 Products
Required fields are marked with *
0
Inquiry Basket