Recombinant Human CCL26 Protein

Cat.No. : CCL26-52H
Product Overview : Recombinant Human CCL26 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 71 amino acid
Description : Recombinant human CCL26 is expressed in E. coli, refolded and purified to yield a mature form of either 68 or 71 amino acids that is secreted from cells after cleavage of the signal peptide. Human CCL26, also known as IMAC, eotaxin 3, and MIP4-alpha, recruits eosinophils and basophils by activating the CCR3 receptor.
Form : Lyophilized
Molecular Mass : 8.39182 kDa
AA Sequence : TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCT HPRKKWVQKYISLLKTPKQL
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 26
Gene Name CCL26 C-C motif chemokine ligand 26 [ Homo sapiens (human) ]
Official Symbol CCL26
Synonyms IMAC; TSC-1; MIP-4a; SCYA26; MIP-4alpha
Gene ID 10344
mRNA Refseq NM_006072
Protein Refseq NP_006063
MIM 604697
UniProt ID Q9Y258

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL26 Products

Required fields are marked with *

My Review for All CCL26 Products

Required fields are marked with *

0
cart-icon