Recombinant Human CCL27 Protein

Cat.No. : CCL27-017H
Product Overview : Recombinant human CCL27 protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Protein Length : 112
Description : This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation.
Form : Lyophilized
AA Sequence : MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Purity : > 97%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered and lyophilized.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name CCL27 chemokine (C-C motif) ligand 27 [ Homo sapiens (human) ]
Official Symbol CCL27
Synonyms CCL27; chemokine (C-C motif) ligand 27; SCYA27, small inducible cytokine subfamily A (Cys Cys), member 27; C-C motif chemokine 27; ALP; CC chemokine ILC; CTACK; CTAK; cutaneous T cell attracting chemokine; ESkine; IL 11 Ralpha locus chemokine; ILC; PESKY; skinkine; IL-11 Ralpha-locus chemokine; small-inducible cytokine A27; IL-11 R-alpha-locus chemokine; cutaneous T-cell attracting chemokine; cutaneous T-cell-attracting chemokine; small inducible cytokine subfamily A (Cys-Cys), member 27; ESKINE; SCYA27;
Gene ID 10850
mRNA Refseq NM_006664
Protein Refseq NP_006655
MIM 604833
UniProt ID Q9Y4X3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL27 Products

Required fields are marked with *

My Review for All CCL27 Products

Required fields are marked with *

0
cart-icon