Recombinant Human CCL27 Protein
Cat.No. : | CCL27-017H |
Product Overview : | Recombinant human CCL27 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 112 |
Description : | This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. |
Form : | Lyophilized |
AA Sequence : | MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
Purity : | > 97% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered and lyophilized. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CCL27 chemokine (C-C motif) ligand 27 [ Homo sapiens (human) ] |
Official Symbol | CCL27 |
Synonyms | CCL27; chemokine (C-C motif) ligand 27; SCYA27, small inducible cytokine subfamily A (Cys Cys), member 27; C-C motif chemokine 27; ALP; CC chemokine ILC; CTACK; CTAK; cutaneous T cell attracting chemokine; ESkine; IL 11 Ralpha locus chemokine; ILC; PESKY; skinkine; IL-11 Ralpha-locus chemokine; small-inducible cytokine A27; IL-11 R-alpha-locus chemokine; cutaneous T-cell attracting chemokine; cutaneous T-cell-attracting chemokine; small inducible cytokine subfamily A (Cys-Cys), member 27; ESKINE; SCYA27; |
Gene ID | 10850 |
mRNA Refseq | NM_006664 |
Protein Refseq | NP_006655 |
MIM | 604833 |
UniProt ID | Q9Y4X3 |
◆ Recombinant Proteins | ||
CCL27-76H | Recombinant Human Chemokine (C-C motif) Ligand 27 | +Inquiry |
CCL27-1212H | Recombinant Human CCL27 Protein (Phe25-Gly112), N-GST tagged | +Inquiry |
Ccl27-681R | Active Recombinant Rat Ccl27 | +Inquiry |
CCL27-255H | Recombinant Human CCL27, His tagged | +Inquiry |
CCL27-3384H | Recombinant Human CCL27 protein(Phe25-Gly112), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL27-302HCL | Recombinant Human CCL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL27 Products
Required fields are marked with *
My Review for All CCL27 Products
Required fields are marked with *