Recombinant Human CCL27 Protein, GST-Tagged
| Cat.No. : | CCL27-0633H |
| Product Overview : | Human CCL27 full-length ORF (NP_006655, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 37.95 kDa |
| AA Sequence : | MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCL27 chemokine (C-C motif) ligand 27 [ Homo sapiens ] |
| Official Symbol | CCL27 |
| Synonyms | CCL27; chemokine (C-C motif) ligand 27; SCYA27, small inducible cytokine subfamily A (Cys Cys), member 27; C-C motif chemokine 27; ALP; CC chemokine ILC; CTACK; CTAK; cutaneous T cell attracting chemokine; ESkine; IL 11 Ralpha locus chemokine; ILC; PESKY; skinkine; IL-11 Ralpha-locus chemokine; small-inducible cytokine A27; IL-11 R-alpha-locus chemokine; cutaneous T-cell attracting chemokine; cutaneous T-cell-attracting chemokine; small inducible cytokine subfamily A (Cys-Cys), member 27; ESKINE; SCYA27; |
| Gene ID | 10850 |
| mRNA Refseq | NM_006664 |
| Protein Refseq | NP_006655 |
| MIM | 604833 |
| UniProt ID | Q9Y4X3 |
| ◆ Recombinant Proteins | ||
| CCL27-017H | Recombinant Human CCL27 Protein | +Inquiry |
| CCL27-517R | Recombinant Rhesus Macaque CCL27 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ccl27-681R | Active Recombinant Rat Ccl27 | +Inquiry |
| CCL27-689R | Recombinant Rhesus monkey CCL27 Protein, His-tagged | +Inquiry |
| CCL27-67H | Recombinant Human CCL27 Protein, Biotin-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL27-302HCL | Recombinant Human CCL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL27 Products
Required fields are marked with *
My Review for All CCL27 Products
Required fields are marked with *
