Recombinant Human CCL28 Protein

Cat.No. : CCL28-54H
Product Overview : Recombinant Human CCL28 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 114 amino acid
Description : Human CCL28 is chemokine that is constitutively expressed by epithelial cells in diverse mucosal tissues and is known to attract a variety of immune cell types including T-cell subsets and eosinophils through activation of the G protein-coupled receptors CCR10 and CCR3. CCL28 contains an extended C-terminal domain consisting of ~40 flexible amino acids. In addition to the two disulfide bonds that are conserved throughout the chemokine family, two additional cysteine residues at positions 30 and 80 form a novel disulfide linkage between the folded chemokine domain and the flexible C-terminus. Human CCL28 is expressed as an immature polypeptide 127 amino acids in length. Two different mature N-terminal sequences have been described due to uncertainty in the site of cleavage by signal peptidase. CCL28(4-108) is described in the NCIB GenPept entry as the mature form based on an ab initio prediction of the site of signal peptide cleavage. It consists of residues 23-127 of the expressed protein and may exhibit higher potency as a CCR10 agonist than the longer version [CCL28(1-108)] that includes three additional N-terminal residues.
Form : Lyophilized
Molecular Mass : 12.070 kDa
AA Sequence : ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKV QAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 28
Gene Name CCL28 C-C motif chemokine ligand 28 [ Homo sapiens (human) ]
Official Symbol CCL28
Synonyms MEC; CCK1; SCYA28
Gene ID 56477
mRNA Refseq NM_148672
Protein Refseq NP_683513
MIM 605240
UniProt ID Q9NRJ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL28 Products

Required fields are marked with *

My Review for All CCL28 Products

Required fields are marked with *

0
cart-icon
0
compare icon