| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
114 amino acid |
| Description : |
Human CCL28 is chemokine that is constitutively expressed by epithelial cells in diverse mucosal tissues and is known to attract a variety of immune cell types including T-cell subsets and eosinophils through activation of the G protein-coupled receptors CCR10 and CCR3. CCL28 contains an extended C-terminal domain consisting of ~40 flexible amino acids. In addition to the two disulfide bonds that are conserved throughout the chemokine family, two additional cysteine residues at positions 30 and 80 form a novel disulfide linkage between the folded chemokine domain and the flexible C-terminus. Human CCL28 is expressed as an immature polypeptide 127 amino acids in length. Two different mature N-terminal sequences have been described due to uncertainty in the site of cleavage by signal peptidase. CCL28(4-108) is described in the NCIB GenPept entry as the mature form based on an ab initio prediction of the site of signal peptide cleavage. It consists of residues 23-127 of the expressed protein and may exhibit higher potency as a CCR10 agonist than the longer version [CCL28(1-108)] that includes three additional N-terminal residues. |
| Form : |
Lyophilized |
| Molecular Mass : |
12.070 kDa |
| AA Sequence : |
ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKV QAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
| Endotoxin : |
Endotoxin-free <0.01 EU/ug |
| Purity : |
Purity assessed by HPLC, Mass Spectrometry, and NMR |
| Storage : |
Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
| tmpcolum67 : |
C-C motif chemokine ligand 28 |