Recombinant Human CCL28 Protein, GST-Tagged
Cat.No. : | CCL28-0634H |
Product Overview : | Human CCL28 full-length ORF (BAG35056.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 40.37 kDa |
AA Sequence : | MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL28 chemokine (C-C motif) ligand 28 [ Homo sapiens ] |
Official Symbol | CCL28 |
Synonyms | CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK1; MEC; mucosae associated epithelial chemokine; SCYA28; small inducible cytokine A28; small inducible cytokine subfamily A (Cys Cys); member 28; small-inducible cytokine A28; mucosae-associated epithelial chemokine; chemokine (C-C motif) ligand 28 splice variant chi; small inducible cytokine subfamily A (Cys-Cys), member 28; MGC71902; |
Gene ID | 56477 |
mRNA Refseq | NM_148672 |
Protein Refseq | NP_683513 |
MIM | 605240 |
UniProt ID | Q9NRJ3 |
◆ Recombinant Proteins | ||
CCL28-019H | Recombinant Human CCL28 Protein, Biotinylated | +Inquiry |
CCL28-1407H | Recombinant Human CCL28 Protein (Ile20-Tyr127) | +Inquiry |
CCL28-018H | Recombinant Human CCL28 Protein | +Inquiry |
Ccl28-2976M | Recombinant Mouse Ccl28 protein | +Inquiry |
Ccl28-152M | Active Recombinant Mouse Ccl28 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL28-7724HCL | Recombinant Human CCL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL28 Products
Required fields are marked with *
My Review for All CCL28 Products
Required fields are marked with *