Recombinant Human CCL28 Protein, His-tagged
| Cat.No. : | CCL28-193H |
| Product Overview : | Recombinant Human CCL28 Protien(NP_683513)(1-127 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-127 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | CCL28 chemokine (C-C motif) ligand 28 [ Homo sapiens ] |
| Official Symbol | CCL28 |
| Synonyms | CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK1; MEC; mucosae associated epithelial chemokine; SCYA28; small inducible cytokine A28; small inducible cytokine subfamily A (Cys Cys); member 28; small-inducible cytokine A28; mucosae-associated epithelial chemokine; chemokine (C-C motif) ligand 28 splice variant chi; small inducible cytokine subfamily A (Cys-Cys), member 28; MGC71902; |
| Gene ID | 56477 |
| mRNA Refseq | NM_148672 |
| Protein Refseq | NP_683513 |
| MIM | 605240 |
| UniProt ID | Q9NRJ3 |
| ◆ Recombinant Proteins | ||
| Ccl28-152M | Active Recombinant Mouse Ccl28 Protein | +Inquiry |
| CCL28-1296H | Recombinant Human CCL28 Protein (Ser20-Gln115), N-His tagged | +Inquiry |
| Ccl28-041C | Active Recombinant Mouse Ccl28 Protein (111 aa) | +Inquiry |
| CCL28-018H | Recombinant Human CCL28 Protein | +Inquiry |
| CCL28-27825TH | Recombinant Human CCL28 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL28-7724HCL | Recombinant Human CCL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL28 Products
Required fields are marked with *
My Review for All CCL28 Products
Required fields are marked with *
