Recombinant Human CCL28 Protein, His-tagged

• Cat.No.: CCL28-193H
• Product Overview: Recombinant Human CCL28 Protien(NP_683513)(1-127 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-127 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: CCL28 chemokine (C-C motif) ligand 28 [ Homo sapiens ]
• Official Symbol: CCL28
• Synonyms: CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK1; MEC; mucosae associated epithelial chemokine; SCYA28; small inducible cytokine A28; small inducible cytokine subfamily A (Cys Cys); member 28; small-inducible cytokine A28; mucosae-associated epithelial chemokine; chemokine (C-C motif) ligand 28 splice variant chi; small inducible cytokine subfamily A (Cys-Cys), member 28; MGC71902
• Gene ID: 56477
• mRNA Refseq: NM_148672
• Protein Refseq: NP_683513
• MIM: 605240
• UniProt ID: Q9NRJ3