Active Recombinant Human CCL3L1 Protein (70 aa)

Cat.No. : CCL3L1-343C
Product Overview : Recombinant human LD78-beta/CCL3L1 (rhLD78-beta) produced in E. coli is a single non-glycosylated polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhLD78-beta has a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 70
Description : LD78-beta/CCL3L1 is a proinflammatory chemokine and the isoform of Macrophage Inflammatory Protein-1 alpha (MIP-1 alpha). LD78-beta is secreted by most mature leukocytes, predominantly macrophages, and its major receptor is the G-protein coupled receptor CCR5, which is also the co-receptor used by the HIV-1 virus for cell entry. LD78-beta has superior antiviral activity and induces a variety of immune cells, particularly CD8+ T cells and immature dendritic cells. LD78-beta attracts lymphocytes and macrophages to sites of inflammation and infection, and its functions are inhibited by Interleukin-4, Interleukin-10, and Interleukin-13. Importantly, the copy number variation of LD78-beta is associated with HIV susceptibility, indicating LD78-beta's critical role in the disease.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.4 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR5, the receptor of human CCL3L1, corresponding to a specific activity of > 2.5 × 10^3 units/mg.
Molecular Mass : 7.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analysis.
Storage : Lyophilized recombinant human LD78-beta/CCL3L1 (rhLD78-beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhLD78-beta remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name CCL3L1 chemokine (C-C motif) ligand 3-like 1 [ Homo sapiens ]
Official Symbol CCL3L1
Synonyms CCL3L1; chemokine (C-C motif) ligand 3-like 1; D17S1718, SCYA3L, SCYA3L1, small inducible cytokine A3 like 1; C-C motif chemokine 3-like 1; G0S19 2; LD78BETA; PAT 464.2; LD78-beta(1-70); small inducible cytokine A3-like 1; small-inducible cytokine A3-like 1; G0/G1 switch regulatory protein 19-2; tonsillar lymphocyte LD78 beta protein; LD78; 464.2; MIP1AP; SCYA3L; G0S19-2; SCYA3L1; D17S1718; MGC12815; MGC104178; MGC182017;
Gene ID 6349
mRNA Refseq NM_021006
Protein Refseq NP_066286
MIM 601395
UniProt ID P16619

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL3L1 Products

Required fields are marked with *

My Review for All CCL3L1 Products

Required fields are marked with *

0
cart-icon