Active Recombinant Human CCL3L1 Protein (70 aa)
Cat.No. : | CCL3L1-343C |
Product Overview : | Recombinant human LD78-beta/CCL3L1 (rhLD78-beta) produced in E. coli is a single non-glycosylated polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhLD78-beta has a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 70 |
Description : | LD78-beta/CCL3L1 is a proinflammatory chemokine and the isoform of Macrophage Inflammatory Protein-1 alpha (MIP-1 alpha). LD78-beta is secreted by most mature leukocytes, predominantly macrophages, and its major receptor is the G-protein coupled receptor CCR5, which is also the co-receptor used by the HIV-1 virus for cell entry. LD78-beta has superior antiviral activity and induces a variety of immune cells, particularly CD8+ T cells and immature dendritic cells. LD78-beta attracts lymphocytes and macrophages to sites of inflammation and infection, and its functions are inhibited by Interleukin-4, Interleukin-10, and Interleukin-13. Importantly, the copy number variation of LD78-beta is associated with HIV susceptibility, indicating LD78-beta's critical role in the disease. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 0.4 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR5, the receptor of human CCL3L1, corresponding to a specific activity of > 2.5 × 10^3 units/mg. |
Molecular Mass : | 7.8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analysis. |
Storage : | Lyophilized recombinant human LD78-beta/CCL3L1 (rhLD78-beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhLD78-beta remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | CCL3L1 chemokine (C-C motif) ligand 3-like 1 [ Homo sapiens ] |
Official Symbol | CCL3L1 |
Synonyms | CCL3L1; chemokine (C-C motif) ligand 3-like 1; D17S1718, SCYA3L, SCYA3L1, small inducible cytokine A3 like 1; C-C motif chemokine 3-like 1; G0S19 2; LD78BETA; PAT 464.2; LD78-beta(1-70); small inducible cytokine A3-like 1; small-inducible cytokine A3-like 1; G0/G1 switch regulatory protein 19-2; tonsillar lymphocyte LD78 beta protein; LD78; 464.2; MIP1AP; SCYA3L; G0S19-2; SCYA3L1; D17S1718; MGC12815; MGC104178; MGC182017; |
Gene ID | 6349 |
mRNA Refseq | NM_021006 |
Protein Refseq | NP_066286 |
MIM | 601395 |
UniProt ID | P16619 |
◆ Recombinant Proteins | ||
CCL3L1-68H | Recombinant Human CCL3L1 | +Inquiry |
CCL3L1-4028H | Recombinant Human CCL3L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL3L1-343C | Active Recombinant Human CCL3L1 Protein (70 aa) | +Inquiry |
CCL3L1-149H | Recombinant Human C motif chemokine ligand 3 like 1 Protein, His&Flag&StrepII tagged | +Inquiry |
CCL3L1-165H | Recombinant Human CCL3L1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3L1-7722HCL | Recombinant Human CCL3L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL3L1 Products
Required fields are marked with *
My Review for All CCL3L1 Products
Required fields are marked with *