Recombinant Human CCL4L2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CCL4L2-1189H
Product Overview : CCL4L1 MS Standard C13 and N15-labeled recombinant protein (NP_001001435) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. This gene copy contains a non-consensus splice acceptor site at the 3' terminal exon found in other highly similar gene copies, and it thus uses other alternative splice sites for the 3' terminal exon, resulting in multiple transcript variants.
Molecular Mass : 10.1 kDa
AA Sequence : MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CCL4L2 C-C motif chemokine ligand 4 like 2 [ Homo sapiens (human) ]
Official Symbol CCL4L2
Synonyms CCL4L1; chemokine (C-C motif) ligand 4-like 1; CCL4L, chemokine (C C motif) ligand 4 like, SCYA4L, small inducible cytokine A4 like; C-C motif chemokine 4-like; AT744.2; LAG 1; MIP-1-beta; macrophage inflammatory protein-1b2; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; monocyte adherence-induced protein 5-alpha; LAG1; CCL4L; LAG-1; SCYA4L;
Gene ID 9560
mRNA Refseq NM_001001435
Protein Refseq NP_001001435
MIM 603782
UniProt ID Q8NHW4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL4L2 Products

Required fields are marked with *

My Review for All CCL4L2 Products

Required fields are marked with *

0
cart-icon
0
compare icon