Recombinant Human CCL4L2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CCL4L2-1189H |
| Product Overview : | CCL4L1 MS Standard C13 and N15-labeled recombinant protein (NP_001001435) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. This gene copy contains a non-consensus splice acceptor site at the 3' terminal exon found in other highly similar gene copies, and it thus uses other alternative splice sites for the 3' terminal exon, resulting in multiple transcript variants. |
| Molecular Mass : | 10.1 kDa |
| AA Sequence : | MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CCL4L2 C-C motif chemokine ligand 4 like 2 [ Homo sapiens (human) ] |
| Official Symbol | CCL4L2 |
| Synonyms | CCL4L1; chemokine (C-C motif) ligand 4-like 1; CCL4L, chemokine (C C motif) ligand 4 like, SCYA4L, small inducible cytokine A4 like; C-C motif chemokine 4-like; AT744.2; LAG 1; MIP-1-beta; macrophage inflammatory protein-1b2; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; monocyte adherence-induced protein 5-alpha; LAG1; CCL4L; LAG-1; SCYA4L; |
| Gene ID | 9560 |
| mRNA Refseq | NM_001001435 |
| Protein Refseq | NP_001001435 |
| MIM | 603782 |
| UniProt ID | Q8NHW4 |
| ◆ Recombinant Proteins | ||
| CCL4L2-627H | Active Recombinant Human CCL4L2 | +Inquiry |
| CCL4L2-1189H | Recombinant Human CCL4L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CCL4L2-27831TH | Recombinant Human CCL4L2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL4L2 Products
Required fields are marked with *
My Review for All CCL4L2 Products
Required fields are marked with *



