Recombinant Human CCL4L2, His-tagged

Cat.No. : CCL4L2-27831TH
Product Overview : Recombinant full length Human CCL4L1 with an N terminal His tag; 94 amino acids, predicted MWt 10.5kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 69 amino acids
Description : This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more telomeric gene.
Conjugation : HIS
Molecular Weight : 10.500kDa inclusive of tags
Tissue specificity : Detected in B-cells.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 10mM Sodium citrate, pH 3.5
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Sequence Similarities : Belongs to the intercrine beta (chemokine CC) family.
Gene Name CCL4L2 chemokine (C-C motif) ligand 4-like 2 [ Homo sapiens ]
Official Symbol CCL4L2
Synonyms CCL4L2; chemokine (C-C motif) ligand 4-like 2;
Gene ID 388372
mRNA Refseq NM_207007
Protein Refseq NP_996890
MIM 610757
Uniprot ID Q8NHW4
Chromosome Location 17q12
Pathway Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL4L2 Products

Required fields are marked with *

My Review for All CCL4L2 Products

Required fields are marked with *

0
cart-icon