Recombinant Human CCL5 protein, His-tagged
Cat.No. : | CCL5-302H |
Product Overview : | Recombinant Human CCL5 protein(P13501)(24-91aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-91aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 11.9 kDa |
AA Sequence : | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CCL5 chemokine (C-C motif) ligand 5 [ Homo sapiens ] |
Official Symbol | CCL5 |
Synonyms | CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E; |
Gene ID | 6352 |
mRNA Refseq | NM_002985 |
Protein Refseq | NP_002976 |
MIM | 187011 |
UniProt ID | P13501 |
◆ Recombinant Proteins | ||
CCL5-3533H | Recombinant Human CCL5 protein, His,SUMO-tagged | +Inquiry |
Ccl5-259M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 5 | +Inquiry |
CCL5-211H | Recombinant Human CCL5 Protein, Mature chain, Tag Free, Biotinylated | +Inquiry |
CCL5-6111H | Recombinant Human CCL5 protein, His-tagged | +Inquiry |
CCL5-151H | Recombinant Human CCL5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *