Recombinant Human CCL8 Protein, His-tagged

Cat.No. : CCL8-031H
Product Overview : Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8) was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. [provided by RefSeq, Sep 2014]
Molecular Mass : 9.95 kDa
AA Sequence : QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKPVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Gene Name CCL8 chemokine (C-C motif) ligand 8 [ Homo sapiens ]
Official Symbol CCL8
Synonyms CCL8; chemokine (C-C motif) ligand 8; SCYA8, small inducible cytokine subfamily A (Cys Cys), member 8 (monocyte chemotactic protein 2); C-C motif chemokine 8; HC14; MCP 2; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); MCP2; MCP-2; SCYA8; SCYA10;
Gene ID 6355
mRNA Refseq NM_005623
Protein Refseq NP_005614
MIM 602283
UniProt ID P80075

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL8 Products

Required fields are marked with *

My Review for All CCL8 Products

Required fields are marked with *

0
cart-icon