Recombinant Human CCNB2 Protein, His-Tagged

• Cat.No.: CCNB2-0654H
• Product Overview: Human CCNB2 (NP_004692, 1 a.a. - 398 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. [provided by RefSeq, Jul 2008]
• Form: Liquid
• Molecular Mass: 47.9 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: In 20mM Tris-HCl buffer, pH 8.0 (50% glycerol, 0.2M NaCl, 5mM DTT).

Gene Information

• Gene Name: CCNB2 cyclin B2 [ Homo sapiens ]
• Official Symbol: CCNB2
• Synonyms: CCNB2; cyclin B2; G2/mitotic-specific cyclin-B2; HsT17299
• Gene ID: 9133
• mRNA Refseq: NM_004701
• Protein Refseq: NP_004692
• MIM: 602755
• UniProt ID: O95067