Recombinant Human CCNB3 Protein, GST-Tagged

Cat.No. : CCNB3-0656H
Product Overview : Human CCNB3 partial ORF (NP_149020, 1296 a.a. - 1395 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as positive regulators of cyclin-dependent kinases (CDKs), and thereby play an essential role in the control of the cell cycle. Different cyclins exhibit distinct expression and degradation patterns, which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chicken and drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and may be required for proper spindle reorganization and restoration of the interphase nucleus. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]
Molecular Mass : 36.74 kDa
AA Sequence : VQEKASKLAAASLLLALYMKKLGYWVPFLEHYSGYSISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLEEILNCDCEAQGLVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCNB3 cyclin B3 [ Homo sapiens ]
Official Symbol CCNB3
Synonyms CCNB3; cyclin B3; G2/mitotic-specific cyclin-B3;
Gene ID 85417
mRNA Refseq NM_033031
Protein Refseq NP_149020
MIM 300456
UniProt ID Q8WWL7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCNB3 Products

Required fields are marked with *

My Review for All CCNB3 Products

Required fields are marked with *

0
cart-icon