Recombinant Human CCNB3 Protein, GST-Tagged
| Cat.No. : | CCNB3-0656H |
| Product Overview : | Human CCNB3 partial ORF (NP_149020, 1296 a.a. - 1395 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as positive regulators of cyclin-dependent kinases (CDKs), and thereby play an essential role in the control of the cell cycle. Different cyclins exhibit distinct expression and degradation patterns, which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chicken and drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and may be required for proper spindle reorganization and restoration of the interphase nucleus. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | VQEKASKLAAASLLLALYMKKLGYWVPFLEHYSGYSISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLEEILNCDCEAQGLVL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCNB3 cyclin B3 [ Homo sapiens ] |
| Official Symbol | CCNB3 |
| Synonyms | CCNB3; cyclin B3; G2/mitotic-specific cyclin-B3; |
| Gene ID | 85417 |
| mRNA Refseq | NM_033031 |
| Protein Refseq | NP_149020 |
| MIM | 300456 |
| UniProt ID | Q8WWL7 |
| ◆ Recombinant Proteins | ||
| CCNB3-6792C | Recombinant Chicken CCNB3 | +Inquiry |
| CCNB3-0656H | Recombinant Human CCNB3 Protein, GST-Tagged | +Inquiry |
| CCNB3-4561Z | Recombinant Zebrafish CCNB3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCNB3-304HCL | Recombinant Human CCNB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNB3 Products
Required fields are marked with *
My Review for All CCNB3 Products
Required fields are marked with *
