Recombinant Human CCNC Protein, GST-Tagged
Cat.No. : | CCNC-0657H |
Product Overview : | Human CCNC full-length ORF (AAH56153, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the cyclin family of proteins. The encoded protein interacts with cyclin-dependent kinase 8 and induces the phophorylation of the carboxy-terminal domain of the large subunit of RNA polymerase II. The level of mRNAs for this gene peaks in the G1 phase of the cell cycle. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 56.87 kDa |
AA Sequence : | MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNC cyclin C [ Homo sapiens ] |
Official Symbol | CCNC |
Synonyms | CCNC; cyclin C; cyclin-C; CycC; hSRB11; SRB11 homolog; |
Gene ID | 892 |
mRNA Refseq | NM_001013399 |
Protein Refseq | NP_001013417 |
MIM | 123838 |
UniProt ID | P24863 |
◆ Recombinant Proteins | ||
CCNC-07H | Recombinant Human Cyclin C | +Inquiry |
CCNC-0657H | Recombinant Human CCNC Protein, GST-Tagged | +Inquiry |
CCNC-10859H | Recombinant Human CCNC, His-tagged | +Inquiry |
CCNC-4033C | Recombinant Chicken CCNC | +Inquiry |
CCNC-2965HF | Recombinant Full Length Human CCNC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNC-7714HCL | Recombinant Human CCNC 293 Cell Lysate | +Inquiry |
CCNC-7715HCL | Recombinant Human CCNC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNC Products
Required fields are marked with *
My Review for All CCNC Products
Required fields are marked with *