Recombinant Human CCND1 protein, His-tagged
Cat.No. : | CCND1-3456H |
Product Overview : | Recombinant Human CCND1 protein(1-42 aa), fused to His tag, was expressed in E. coli. |
Availability | September 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-42 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CCND1 cyclin D1 (PRAD1: parathyroid adenomatosis 1) [ Homo sapiens ] |
Official Symbol | CCND1 |
Synonyms | CCND1; cyclin D1 (PRAD1: parathyroid adenomatosis 1); BCL1, cyclin D1 (PRAD1: parathyroid adenomatosis 1) , D11S287E, PRAD1; B cell CLL/lymphoma 1; G1/S specific cyclin D1; parathyroid adenomatosis 1; U21B31; BCL-1; PRAD1; D11S287E; |
Gene ID | 893 |
MIM | 168461 |
UniProt ID | P24385 |
◆ Recombinant Proteins | ||
CCND1-354H | Recombinant Human CCND1 protein, His/MBP-tagged | +Inquiry |
CCND1-2608C | Recombinant Cattle CCND1 protein, His & T7-tagged | +Inquiry |
Ccnd1-2611R | Recombinant Rat Ccnd1 protein, His-tagged | +Inquiry |
CCND1-3824HFL | Recombinant Full Length Human CCND1 protein, Flag-tagged | +Inquiry |
CCND1-1140H | Recombinant Human CCND1 Protein (Lue65-Arg245), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND1-7713HCL | Recombinant Human CCND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND1 Products
Required fields are marked with *
My Review for All CCND1 Products
Required fields are marked with *