Recombinant Human CCND2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CCND2-6157H |
Product Overview : | CCND2 MS Standard C13 and N15-labeled recombinant protein (NP_001750) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK4 or CDK6 and functions as a regulatory subunit of the complex, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. Mutations in this gene are associated with megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3). |
Molecular Mass : | 33.1 kDa |
AA Sequence : | MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CCND2 cyclin D2 [ Homo sapiens (human) ] |
Official Symbol | CCND2 |
Synonyms | CCND2; cyclin D2; G1/S-specific cyclin-D2; G1/S specific cyclin D2; G1/S-specific cyclin D2; KIAK0002; MGC102758; |
Gene ID | 894 |
mRNA Refseq | NM_001759 |
Protein Refseq | NP_001750 |
MIM | 123833 |
UniProt ID | P30279 |
◆ Recombinant Proteins | ||
Ccnd2-799M | Recombinant Mouse Ccnd2 Protein, MYC/DDK-tagged | +Inquiry |
CCND2-10861H | Recombinant Human CCND2, GST-tagged | +Inquiry |
CCND2-1601H | Recombinant Human CCND2 Protein (Met1-Leu289), N-His tagged | +Inquiry |
CCND2-5787C | Recombinant Chicken CCND2 | +Inquiry |
CCND2-2969HF | Recombinant Full Length Human CCND2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND2-7712HCL | Recombinant Human CCND2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCND2 Products
Required fields are marked with *
My Review for All CCND2 Products
Required fields are marked with *
0
Inquiry Basket