Recombinant Human CCND3 protein, His-tagged
Cat.No. : | CCND3-2532H |
Product Overview : | Recombinant Human CCND3 protein(1-292 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-292 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CCND3 cyclin D3 [ Homo sapiens ] |
Official Symbol | CCND3 |
Synonyms | CCND3; cyclin D3; G1/S-specific cyclin-D3; D3-type cyclin; G1/S-specific cyclin D3; |
Gene ID | 896 |
mRNA Refseq | NM_001136017 |
Protein Refseq | NP_001129489 |
MIM | 123834 |
UniProt ID | P30281 |
◆ Recombinant Proteins | ||
CCND3-1534Z | Recombinant Zebrafish CCND3 | +Inquiry |
CCND3-0896H | Recombinant Human CCND3 Protein (Met1-Leu292), N-His tagged | +Inquiry |
CCND3-840H | Recombinant Human CCND3 protein, His/T7-tagged | +Inquiry |
CCND3-879R | Recombinant Rat CCND3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCND3-699R | Recombinant Rhesus monkey CCND3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND3-305HCL | Recombinant Human CCND3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND3 Products
Required fields are marked with *
My Review for All CCND3 Products
Required fields are marked with *