Recombinant Human CCNG2 protein, GST-tagged
| Cat.No. : | CCNG2-301247H | 
| Product Overview : | Recombinant Human CCNG2 (24-155 aa) protein, fused to GST tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | Tyr24-Ala155 | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| AA Sequence : | YLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKRMEKIISEKLHYELEA | 
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | CCNG2 cyclin G2 [ Homo sapiens ] | 
| Official Symbol | CCNG2 | 
| Synonyms | CCNG2; cyclin G2; cyclin-G2; | 
| Gene ID | 901 | 
| mRNA Refseq | NM_004354 | 
| Protein Refseq | NP_004345 | 
| MIM | 603203 | 
| UniProt ID | Q16589 | 
| ◆ Recombinant Proteins | ||
| CCNG2-12387Z | Recombinant Zebrafish CCNG2 | +Inquiry | 
| CCNG2-3320H | Recombinant Human CCNG2 protein, His-tagged | +Inquiry | 
| CCNG2-301247H | Recombinant Human CCNG2 protein, GST-tagged | +Inquiry | 
| CCNG2-2801H | Recombinant Human CCNG2 protein, His-tagged | +Inquiry | 
| CCNG2-2996M | Recombinant Mouse CCNG2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CCNG2-7706HCL | Recombinant Human CCNG2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNG2 Products
Required fields are marked with *
My Review for All CCNG2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            