Recombinant Human CCNG2 protein, His-tagged
Cat.No. : | CCNG2-2801H |
Product Overview : | Recombinant Human CCNG2 protein(24-155 aa), fused to His tag, was expressed in E. coli. |
Availability | August 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-155 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKRMEKIISEKLHYELEA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CCNG2 cyclin G2 [ Homo sapiens ] |
Official Symbol | CCNG2 |
Synonyms | CCNG2; cyclin G2; cyclin-G2; |
Gene ID | 901 |
mRNA Refseq | NM_004354 |
Protein Refseq | NP_004345 |
MIM | 603203 |
UniProt ID | Q16589 |
◆ Recombinant Proteins | ||
CCNG2-2996M | Recombinant Mouse CCNG2 Protein | +Inquiry |
CCNG2-2975HF | Recombinant Full Length Human CCNG2 Protein, GST-tagged | +Inquiry |
CCNG2-1409M | Recombinant Mouse CCNG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNG2-3320H | Recombinant Human CCNG2 protein, His-tagged | +Inquiry |
CCNG2-12387Z | Recombinant Zebrafish CCNG2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNG2-7706HCL | Recombinant Human CCNG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNG2 Products
Required fields are marked with *
My Review for All CCNG2 Products
Required fields are marked with *