Recombinant Human CCNK Protein (251-370 aa), His-tagged
Cat.No. : | CCNK-11H |
Product Overview : | Recombinant Human CCNK Protein(O75909, 251-370 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 251-370 aa |
Form : | 0.15 M Phosphate buffered saline |
AA Sequence : | CHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPSQPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIETTHPPLPPAHP |
Storage : | Store at -20°C to -80°C for 12 months in lyophilized form. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | CCNK cyclin K [ Homo sapiens ] |
Official Symbol | CCNK |
Synonyms | CCNK; cyclin K; cyclin-K; CPR4; MGC9113; |
Gene ID | 8812 |
mRNA Refseq | NM_001099402 |
Protein Refseq | NP_001092872 |
MIM | 603544 |
UniProt ID | O75909 |
◆ Recombinant Proteins | ||
CCNK-2872C | Recombinant Chicken CCNK | +Inquiry |
CCNK-2979H | Recombinant Full Length Human CCNK Protein, Flag-tagged | +Inquiry |
CCNK-2980HF | Recombinant Full Length Human CCNK Protein, GST-tagged | +Inquiry |
CCNK-11H | Recombinant Human CCNK Protein (251-370 aa), His-tagged | +Inquiry |
CCNK-2207H | Recombinant Full Length Human CCNK protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNK-306HCL | Recombinant Full Length Human CCNK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNK Products
Required fields are marked with *
My Review for All CCNK Products
Required fields are marked with *