Recombinant Human CCNK Protein (251-370 aa), His-tagged

• Cat.No.: CCNK-11H
• Product Overview: Recombinant Human CCNK Protein(O75909, 251-370 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 251-370 aa
• Form: 0.15 M Phosphate buffered saline
• AA Sequence: CHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPSQPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIETTHPPLPPAHP
• Storage: Store at -20°C to -80°C for 12 months in lyophilized form.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CCNK cyclin K [ Homo sapiens ]
• Official Symbol: CCNK
• Synonyms: CCNK; cyclin K; cyclin-K; CPR4; MGC9113
• Gene ID: 8812
• mRNA Refseq: NM_001099402
• Protein Refseq: NP_001092872
• MIM: 603544
• UniProt ID: O75909