Recombinant Human CCNK Protein (251-370 aa), His-tagged

Cat.No. : CCNK-11H
Product Overview : Recombinant Human CCNK Protein(O75909, 251-370 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 251-370 aa
Form : 0.15 M Phosphate buffered saline
AA Sequence : CHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPSQPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIETTHPPLPPAHP
Storage : Store at -20°C to -80°C for 12 months in lyophilized form.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name CCNK cyclin K [ Homo sapiens ]
Official Symbol CCNK
Synonyms CCNK; cyclin K; cyclin-K; CPR4; MGC9113;
Gene ID 8812
mRNA Refseq NM_001099402
Protein Refseq NP_001092872
MIM 603544
UniProt ID O75909

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCNK Products

Required fields are marked with *

My Review for All CCNK Products

Required fields are marked with *

0
cart-icon
0
compare icon