Recombinant Human CCR7 Protein
Cat.No. : | CCR7-0696H |
Product Overview : | Human CCR7 full-length ORF (NP_001829.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014] |
Form : | Liquid |
Molecular Mass : | 42.9 kDa |
AA Sequence : | MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CCR7 chemokine (C-C motif) receptor 7 [ Homo sapiens ] |
Official Symbol | CCR7 |
Synonyms | CCR7; chemokine (C-C motif) receptor 7; CMKBR7, EBI1; C-C chemokine receptor type 7; BLR2; CD197; CDw197; CCR-7; CC-CKR-7; C-C CKR-7; MIP-3 beta receptor; CC chemokine receptor 7; chemokine (C-C) receptor 7; Epstein-Barr virus induced gene 1; EBV-induced G protein-coupled receptor 1; EBV-induced G-protein coupled receptor 1; Epstein-Barr virus induced G-protein coupled receptor; lymphocyte-specific G protein-coupled peptide receptor; epstein-Barr virus-induced G-protein coupled receptor 1; EBI1; CMKBR7; |
Gene ID | 1236 |
mRNA Refseq | NM_001838 |
Protein Refseq | NP_001829 |
MIM | 600242 |
UniProt ID | P32248 |
◆ Recombinant Proteins | ||
CCR7-3045H | Recombinant Human CCR7 Protein, MYC/DDK-tagged | +Inquiry |
CCR7-537R | Recombinant Rhesus Macaque CCR7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCR7-853H | Active Recombinant Human CCR7 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CCR7-213H | Recombinant Human CCR7 Protein, His-tagged | +Inquiry |
CCR7-4640H | Recombinant Human CCR7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCR7 Products
Required fields are marked with *
My Review for All CCR7 Products
Required fields are marked with *
0
Inquiry Basket