Recombinant Human CCR7 Protein

Cat.No. : CCR7-0696H
Product Overview : Human CCR7 full-length ORF (NP_001829.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014]
Form : Liquid
Molecular Mass : 42.9 kDa
AA Sequence : MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CCR7 chemokine (C-C motif) receptor 7 [ Homo sapiens ]
Official Symbol CCR7
Synonyms CCR7; chemokine (C-C motif) receptor 7; CMKBR7, EBI1; C-C chemokine receptor type 7; BLR2; CD197; CDw197; CCR-7; CC-CKR-7; C-C CKR-7; MIP-3 beta receptor; CC chemokine receptor 7; chemokine (C-C) receptor 7; Epstein-Barr virus induced gene 1; EBV-induced G protein-coupled receptor 1; EBV-induced G-protein coupled receptor 1; Epstein-Barr virus induced G-protein coupled receptor; lymphocyte-specific G protein-coupled peptide receptor; epstein-Barr virus-induced G-protein coupled receptor 1; EBI1; CMKBR7;
Gene ID 1236
mRNA Refseq NM_001838
Protein Refseq NP_001829
MIM 600242
UniProt ID P32248

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCR7 Products

Required fields are marked with *

My Review for All CCR7 Products

Required fields are marked with *

0
cart-icon