Recombinant Human CCR8 Transmembrane protein, His-tagged(Nanodisc)

Cat.No. : CCR8-1480H
Product Overview : Recombinant Human CCR8 protein(P51685)(74-129aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 74-129aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 9.4 kDa
AA Sequence : LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CCR8 chemokine (C-C motif) receptor 8 [ Homo sapiens ]
Official Symbol CCR8
Synonyms CCR8; chemokine (C-C motif) receptor 8; CMKBR8, CMKBRL2; C-C chemokine receptor type 8; CDw198; CKR L1; CY6; GPR CY6; TER1; CC chemokine receptor 8; chemokine receptor-like 1; chemokine (C-C) receptor 8; CC chemokine receptor CHEMR1; CC-chemokine receptor chemr1; chemokine (C-C) receptor-like 2; CCR-8; CKRL1; CMKBR8; GPRCY6; CMKBRL2; CC-CKR-8; MGC129966; MGC129973;
Gene ID 1237
mRNA Refseq NM_005201
Protein Refseq NP_005192
MIM 601834
UniProt ID P51685

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCR8 Products

Required fields are marked with *

My Review for All CCR8 Products

Required fields are marked with *

0
cart-icon
0
compare icon