Recombinant Human CCR9 Protein
Cat.No. : | CCR9-0699H |
Product Overview : | Human CCR9 full-length ORF (NP_112477.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to the chemokine receptor gene cluster region. Two alternatively spliced transcript variants have been described. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012] |
Form : | Liquid |
Molecular Mass : | 42 kDa |
AA Sequence : | MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CCR9 chemokine (C-C motif) receptor 9 [ Homo sapiens ] |
Official Symbol | CCR9 |
Synonyms | CCR9; chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9; |
Gene ID | 10803 |
mRNA Refseq | NM_001256369 |
Protein Refseq | NP_001243298 |
MIM | 604738 |
UniProt ID | P51686 |
◆ Recombinant Proteins | ||
CCR9-16H | Recombinant Human Full Length CCR9 protein, His-tagged(VLPs) | +Inquiry |
CCR9-129C | Recombinant Cynomolgus Monkey CCR9 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35509MF | Recombinant Full Length Mouse C-C Chemokine Receptor Type 9(Ccr9) Protein, His-Tagged | +Inquiry |
CCR9-716H | Recombinant Human CCR9 | +Inquiry |
CCR9-381C | Recombinant Cynomolgus CCR9 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CCR9-13HCL | Recombinant Full Length Human CCR9 Over-expression Lysate, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR9-310HCL | Recombinant Human CCR9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR9 Products
Required fields are marked with *
My Review for All CCR9 Products
Required fields are marked with *
0
Inquiry Basket